PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G039800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 569aa    MW: 63574.1 Da    PI: 9.5089
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G039800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.31.8e-1566154298
                         EEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   2 fkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         f v++p  +++  rl++p +f  ++  +++++   ++l+ +sg+ W  +l      ++ ++++GWkeFv+++ +++g f++F++dgrs+f 
  Brast05G039800.1.p  66 FRVFLPQQYGE--RLRIPLSFN-QYlRNQPAG--VVSLKGQSGNIWLAEL--AVDTEGLFFANGWKEFVRDHSIETGHFLTFRYDGRSKF- 148
                         55665555554..69******8.665666666..7***************..999999****************************9999. PP

                         .EEEEE- CS
                  B3  92 lvvkvfr 98 
                           v vf+
  Brast05G039800.1.p 149 -SVVVFD 154
                         .666665 PP

2B345.51.3e-14463553498
                         E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                         +++ s+v     + lp  f++++   ++ +k+l+l d++g+sW+v++ y   +    +++GW++F   n+L+  D++vF+l+++   + +v
  Brast05G039800.1.p 463 IMKESYVYVGFFMNLPCGFVRDCL--PRANKKLKLWDPQGKSWDVNYVYYSARAVGAFSGGWSKFSLGNNLEKFDICVFELISK--DNIKV 549
                         6788999999999*********95..345679***************887777777899*********************9974..44588 PP

                         EEE- CS
                  B3  95 kvfr 98 
                         +++r
  Brast05G039800.1.p 550 HIYR 553
                         8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.5E-1963156IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.53563156IPR003340B3 DNA binding domain
SuperFamilySSF1019364.71E-1964156IPR015300DNA-binding pseudobarrel domain
CDDcd100176.63E-1665154No hitNo description
SMARTSM010194.7E-1465156IPR003340B3 DNA binding domain
PfamPF023627.0E-1467154IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-23452553IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-22453553IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.478460555IPR003340B3 DNA binding domain
SMARTSM010192.6E-13460555IPR003340B3 DNA binding domain
PfamPF023621.9E-12462553IPR003340B3 DNA binding domain
CDDcd100171.32E-20462553No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0034613Biological Processcellular protein localization
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MGRRQEQGSR RREQQERERR RREELEKEES TAAAAAMAAA EKEKEKDNEK EKEKEGEEEK  60
FGQQFFRVFL PQQYGERLRI PLSFNQYLRN QPAGVVSLKG QSGNIWLAEL AVDTEGLFFA  120
NGWKEFVRDH SIETGHFLTF RYDGRSKFSV VVFDGKCIEK PSAFHAKPCK DLVVKLENGE  180
GDMDMNATDP SQILVAPLGG SNEDTRERVS EMDANGTILQ RFSSVLKKGK KVSPGVLVGT  240
NKTASTILNK DMSGADQSES VPHEESIGTT RKRIREMDAN GSTSEKCSKV SEMVMKKGPE  300
ASVVNNEAST SLNMDMNAAG PAESLVATPE DSNGTTRKRV KEINVNDSTF KKCSSASVKG  360
KEKCPVASVG TYKSTSTSRK STEESDSESS MLEQSISCIK AEMSSPMRLR KNKDVPKCGK  420
YIATGQRQLV VISQRPPVTE EQKNHALQRA KKFKSKNPFA LQIMKESYVY VGFFMNLPCG  480
FVRDCLPRAN KKLKLWDPQG KSWDVNYVYY SARAVGAFSG GWSKFSLGNN LEKFDICVFE  540
LISKDNIKVH IYRVVPEIIP FLSGPNRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1543855427142B3 domain-containing transcription factor VRN
4i1k_B1e-1543855427142B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11722ERRRRE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00192DAPTransfer from AT1G49480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576206.10.0PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1
SwissprotQ2R9D22e-85Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLI1IMS60.0I1IMS6_BRADI; Uncharacterized protein
STRINGBRADI4G23270.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60130.24e-17B3 family protein